Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650501.1 | 3prime_partial | 254 | 46-807(+) |
Amino Acid sequence : | |||
MADVEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEKLAYIAYDYEQELETAKTSSSVEK SYELPDGQVITIGA | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 12,402.277 | ||
Theoretical pI: | 8.951 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 38.451 | ||
aromaticity | 0.111 | ||
GRAVY | -0.037 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.194 | ||
sheet | 0.167 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650501.1 | complete | 108 | 570-244(-) |
Amino Acid sequence : | |||
MGKGISFIDRHCVAHTVTGIEDNTSCTATGIKGKNSLDCHIHCRSIEGLKHDLCHFFTVSLGIQRRFSEKNRVFFRGHAKLVVERMMPDFLHVIPIAYYTMFNWVFQS* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,402.277 | ||
Theoretical pI: | 8.951 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 38.451 | ||
aromaticity | 0.111 | ||
GRAVY | -0.037 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.194 | ||
sheet | 0.167 |