Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650503.1 | internal | 273 | 2-820(+) |
Amino Acid sequence : | |||
FFPRLIAATLRSSFPEREHLLAMSSESEIPPKTSLPSENDSNVDAVADEIGKATLSKKAAKKEAAKLEKLKRQQEAAAAAAAAAAAAVESDPLAGNYGDVALIDLQSKAVSGRKWTEIGS LNQDLKDKEVLIRGRVQTSRAVGKNIAFLVLRERGFTVQCVLTVAPELVSRGMVKYASGLSRESHVDIHGVVSVPSEPIKGASQQVEVHVRKLYCISKAVPNLPINIEDAARSEAEIEKA SQAGEQLVRVNQDTRLNFRVLDMRTPANQAIFR | |||
Physicochemical properties | |||
Number of amino acids: | 273 | ||
Molecular weight: | 19,029.422 | ||
Theoretical pI: | 10.681 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 43.644 | ||
aromaticity | 0.090 | ||
GRAVY | -0.424 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.301 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650503.1 | 5prime_partial | 166 | 820-320(-) |
Amino Acid sequence : | |||
AKDCLISRSAHIKNSKIQTRVLINTNKLLSSLRSFLNFSLASGSILDVDWKIWHSFANTIKFSHMNFHLLRGSLNRFTGNRNNTMNINMRFPAQTRGVLHHSSTNKLWSDRENALHRESP LSQYQKGDILPDCTARLNSSTNQNFLVLQILIERSDFRPFPAGNSF* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 19,029.422 | ||
Theoretical pI: | 10.681 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 43.644 | ||
aromaticity | 0.090 | ||
GRAVY | -0.424 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.301 | ||
sheet | 0.205 |