Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650518.1 | internal | 299 | 2-898(+) |
Amino Acid sequence : | |||
FMATFFNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIK YIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANN LVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNLINHV | |||
Physicochemical properties | |||
Number of amino acids: | 299 | ||
Molecular weight: | 32,820.981 | ||
Theoretical pI: | 8.608 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33350 33350 | ||
Instability index: | 46.438 | ||
aromaticity | 0.100 | ||
GRAVY | -0.032 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.301 | ||
sheet | 0.214 |