Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650523.1 | 3prime_partial | 256 | 26-793(+) |
Amino Acid sequence : | |||
MRSSWVLIVLPLISLVGVALAQDLTSLISEATFNEMLKHRGEGNCRGRLYTYNAFITAARSFNGFATTGSPDDRKREIAAFFGQTSHETTGGWPAAPDGPFAWGYCFVEEQGNPGDYCRS SPQWPCAPGKKYYGRGPIQISWNYNYGQAGRAIGVDLINNPELVATDPVISFKTALWFWMTPQSPKPSCHDVILGRWRPSAADQGAGRVPGYGLITNIINGGIECGKGQNPQVENRIGFY RRYCSMLGVNPGGNLD | |||
Physicochemical properties | |||
Number of amino acids: | 256 | ||
Molecular weight: | 10,865.443 | ||
Theoretical pI: | 8.264 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 46.262 | ||
aromaticity | 0.010 | ||
GRAVY | -0.095 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.220 | ||
sheet | 0.340 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650523.1 | complete | 100 | 213-515(+) |
Amino Acid sequence : | |||
MALLPLAAPTIVRGRSQLSLAKLPMKLLEGGLLHLTDHSHGVTASLKNRAIPEIIVDRVLSGLVLQARNITAEDQSRFHGTTTMDKREEPLELTSSTTQS* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,865.443 | ||
Theoretical pI: | 8.264 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 46.262 | ||
aromaticity | 0.010 | ||
GRAVY | -0.095 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.220 | ||
sheet | 0.340 |