Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650529.1 | internal | 255 | 2-766(+) |
Amino Acid sequence : | |||
ASASTSIPTMPLRFSSTAPTSSFLRFLHHPLKNSPGLISFKLGVRTIRPFSDSPTSVFTTKAVLSQQYQKIGADSNGPVPMNQLLQVAEMAAITGAEVVMDAVNKPRNITYKGLTDLVTD TDEMSEAAILGVVNKNFKEHLILGEEGGVIGNTSSDYLWCIDPLDGTTNFAHGYPSFAVSVGVLFRGKPAAAAVVEFVGGPMCWNTRTFTASSGGGAFCNGQKIHVSKTDQVEQSLLVTG FGYEHDDAWAANMNL | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 27,209.513 | ||
Theoretical pI: | 5.850 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 29.500 | ||
aromaticity | 0.086 | ||
GRAVY | -0.011 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.286 | ||
sheet | 0.235 |