Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650540.1 | 5prime_partial | 223 | 1-672(+) |
Amino Acid sequence : | |||
NEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRN LFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNLINHVRNGTPKRPGRPIETYIFAMFNEDRKSPEFEKHFGLFYPSKQPVYPINFA* | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 24,876.844 | ||
Theoretical pI: | 8.068 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24870 24870 | ||
Instability index: | 47.308 | ||
aromaticity | 0.126 | ||
GRAVY | -0.228 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.314 | ||
sheet | 0.193 |