Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650557.1 | internal | 277 | 3-833(+) |
Amino Acid sequence : | |||
SLRVFSFKFRVRAMASHIVGYPRTGPKRELKFALESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNAAVPAM EMTKWFDTNYHFIVPELGPDTKFSYASHKAVNEYNEAKAFGVDTVPVLVGPVSYLLLSKHAKGTDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEKLKAFTAAYS ELESTLSGVNVVIETYFADVPAEAYKTLTSLKGVTGF | |||
Physicochemical properties | |||
Number of amino acids: | 277 | ||
Molecular weight: | 30,556.403 | ||
Theoretical pI: | 5.787 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46870 46870 | ||
Instability index: | 27.819 | ||
aromaticity | 0.126 | ||
GRAVY | -0.049 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.231 | ||
sheet | 0.278 |