Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650558.1 | internal | 267 | 3-803(+) |
Amino Acid sequence : | |||
AWLRLPTEVDAATRKMFIEEVMELVELTSLRGSLVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGG QEIYVGPLGHHSCHLISYFEGIEGVSKIKDGYNPATWMLEVTTGAQEGILGIDFAEYYRNSDLYRRNKALIQELSTPPAGSEDLYFPTKYSRTFFTQCMACLWKQYWSYWRNPPYTAVRL FFTTVIALMFGTIFWDLGSKTNSPQDL | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 10,218.671 | ||
Theoretical pI: | 9.184 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 43.133 | ||
aromaticity | 0.030 | ||
GRAVY | 0.432 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.313 | ||
sheet | 0.232 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650558.1 | 3prime_partial | 99 | 298-2(-) |
Amino Acid sequence : | |||
MVHTTVLPVSTVFLTVLITIAAALASRPEVGSSMKMIDGFATSSTAIVSLLRCSVERPSTPGKPTNDPLNEVSSTSSITSSINIFLVAASTSVGKRSHA | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,218.671 | ||
Theoretical pI: | 9.184 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 43.133 | ||
aromaticity | 0.030 | ||
GRAVY | 0.432 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.313 | ||
sheet | 0.232 |