Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650575.1 | internal | 260 | 2-781(+) |
Amino Acid sequence : | |||
LDVLEIIAKLSASGASGHVSVPEIVALLPSQKPEASKVMLDRMLRLLASYKILICSMGDNGERSYGLAPVAKFLVKNDDGVSMAPLVLMNQDKVLMESWYHLKDAVLDGGIPFNKAYGMT AFEYHGKDPRFNKVFNRGMSDHSTITMKKLLETYTGFNGLKSVVDVGGGIGATLNMIISKHPTIKGINFDLPHVTEDAPSYPGVEHVGGDMFVSVPKGDAIFMKWILHDWSDDHCAKFLK NCYESLPKDGKGDHCGINST | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 14,542.613 | ||
Theoretical pI: | 7.238 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 49.242 | ||
aromaticity | 0.047 | ||
GRAVY | -0.122 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.271 | ||
sheet | 0.233 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650575.1 | complete | 129 | 427-38(-) |
Amino Acid sequence : | |||
MVGHSPIENFVESWIFSMVLKCSHAISLVKWNSSIKNCILQVIPAFHEDLVLVHEHKRSHGNPIIILHQELSHRCEPITSLTVIPHRANQDLITSQQPQHPIKHHLASLWLLAGEQGHNL GNRNMAGSP* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,542.613 | ||
Theoretical pI: | 7.238 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 49.242 | ||
aromaticity | 0.047 | ||
GRAVY | -0.122 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.271 | ||
sheet | 0.233 |