Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650586.1 | internal | 248 | 1-744(+) |
Amino Acid sequence : | |||
LLLGLFLASLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSQQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVP FVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASL EKAGGGGL | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 27,420.019 | ||
Theoretical pI: | 8.970 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 45.131 | ||
aromaticity | 0.101 | ||
GRAVY | -0.038 | ||
Secondary Structure Fraction | |||
Helix | 0.367 | ||
turn | 0.298 | ||
sheet | 0.214 |