Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650595.1 | internal | 252 | 3-758(+) |
Amino Acid sequence : | |||
NMASLRFISASIPSSPFRPNRIRAGPGQVAAPSSSEVASVEESRLEPRVEERGGYWVLKEKYRQGINPQEKVKLEKEPMTLAMERGINELAKIPIEEIDKSKLTKDDIDVRLKWLGLFHR RKHQYGRFMMRLKLPNGVTTSSQTRYLASVIRKYGKEGCGDVTTRQNWQIRGVVLPDVPEIIEGLNQVGLTSLQSGMDNVRNPVGNPIAGIDPLEIVDTRPYTNLLSQFITANSRGNPSV SNLPRKWNVCVV | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 11,081.517 | ||
Theoretical pI: | 7.732 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 63.855 | ||
aromaticity | 0.119 | ||
GRAVY | 0.113 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.356 | ||
sheet | 0.228 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650595.1 | complete | 101 | 388-83(-) |
Amino Acid sequence : | |||
MNLPYWCFLRWKRPSHLRRTSMSSLVSLDLSISSIGILASSLIPLSMARVMGSFSNFTFSCGFMPCLYFSFSTQYPPLSSTLGSSRDSSTDATSDDEGAAT* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,081.517 | ||
Theoretical pI: | 7.732 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 63.855 | ||
aromaticity | 0.119 | ||
GRAVY | 0.113 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.356 | ||
sheet | 0.228 |