Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650610.1 | internal | 249 | 2-748(+) |
Amino Acid sequence : | |||
GTPSHIDDRFSTDDGSEIEEGEWIPEDTNHAAELSKRIGNEGGASWDEENWQAQYGQVVLSAEAEPLFPVTDLWDWTMVKEIVERKKHGRKKRQKIARLVGKLVKPSSKLHPSMPSGGRI LKTAAICEVHLALVRVSSGQVYRLRSPSLKYLSSLSTYDSSNPTKDWGFPDLTIAEQDIHLPNIGGSCNHKTPDELPPCGDPSAMSDQPKITQKDKSSLYRDRAAERRMLHGGYGIGPGQ KNSRTMDMT | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 27,664.727 | ||
Theoretical pI: | 6.491 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 42065 | ||
Instability index: | 44.489 | ||
aromaticity | 0.060 | ||
GRAVY | -0.764 | ||
Secondary Structure Fraction | |||
Helix | 0.233 | ||
turn | 0.281 | ||
sheet | 0.225 |