Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650611.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
EEDLLMAGKHFKYVIIGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPESPARLPGFHVCVGSGGERLAPGWYTEKGIELILSTEIVKVDLASKSLVSATGLTFKY DTLLIATGSTVIRLTDFGVQGADAKNIFYLREIDDADKLIVAINAKKNGKAVIVGGGYIGLELGAVMKLNNFDVTMVYPEPWCMPRLFTSGIAAFYEGYYANKGIKIVKGTVAVGFDSNA DGEVRAVKLKDGRVLGADIVV | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 12,734.199 | ||
Theoretical pI: | 6.378 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 55.928 | ||
aromaticity | 0.117 | ||
GRAVY | -0.064 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.306 | ||
sheet | 0.135 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650611.1 | 3prime_partial | 125 | 376-2(-) |
Amino Acid sequence : | |||
MSKVSYLKVNPVALTRDFEARSTFTISVLRINSMPFSVYHPGASLSPPLPTQTWKPGSLAGDSGKRYALLRAGRSYGATASFEIIASSPGLTPCFANSLAAYPAATPPPMITYLKCFPAI NKSSS | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 12,734.199 | ||
Theoretical pI: | 6.378 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 55.928 | ||
aromaticity | 0.117 | ||
GRAVY | -0.064 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.306 | ||
sheet | 0.135 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650611.1 | 5prime_partial | 111 | 785-450(-) |
Amino Acid sequence : | |||
NNNISTEDPSILQFHCSHLPICIGIKSNCNCSLDNFDSFVSIVTFIECSYSRSEETRHAPWFRVHHSNIEVVKLHYSAKLETNVSSTNNHSLTILFCINSYYKFISIINFS* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,734.199 | ||
Theoretical pI: | 6.378 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 55.928 | ||
aromaticity | 0.117 | ||
GRAVY | -0.064 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.306 | ||
sheet | 0.135 |