Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650612.1 | 3prime_partial | 221 | 110-772(+) |
Amino Acid sequence : | |||
MFGRAPKRSDNTKYYEVLGVPKSASADELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGSAGHNPFDIFESFFGGGVFGGGGSSRGRRQKQGDD VVHSLKVSLEDLYNGTSKKLSLSRNVLCSKCKGKGSKSGAPSRCYGCQGTGVKVTTRPIGPGMIQQMQHACPECRGSGEVISDKDRCPQCKGNKVIQEKKV | |||
Physicochemical properties | |||
Number of amino acids: | 221 | ||
Molecular weight: | 13,189.791 | ||
Theoretical pI: | 8.388 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 37.375 | ||
aromaticity | 0.061 | ||
GRAVY | 0.302 | ||
Secondary Structure Fraction | |||
Helix | 0.386 | ||
turn | 0.132 | ||
sheet | 0.333 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650612.1 | complete | 114 | 282-626(+) |
Amino Acid sequence : | |||
MKCLVILRREKFMINTEKMPLKREWEGVVLVTILLTYLNHFLVVEFLEVVVVPGDEGKNKVMMLFTASRFLSRTCIMEHLKSSLCQEMSCAQNAKGKVQRVELLVDVMDVKVLE* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 13,189.791 | ||
Theoretical pI: | 8.388 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 37.375 | ||
aromaticity | 0.061 | ||
GRAVY | 0.302 | ||
Secondary Structure Fraction | |||
Helix | 0.386 | ||
turn | 0.132 | ||
sheet | 0.333 |