Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650614.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
SAAVSRDALAKIVYSRLFDWLVNKINCSIGQDPDSKILIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFNQHVFKMEQEEYTKEEIDWSYIEFVDNQDVLDLIEKKPGGIIALLDEAC MFPRSTHETFAQKLYQTFKNHKRFSKPKLSRTDFTICHYAGDVTYQTDLFLDKNKDYVVAEHQALLSASRCSFVSGLFPPLSEESSKTSKFSSIGSRFKQQLQALLETLSSTEPHYIRCV KPNSL | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 28,198.631 | ||
Theoretical pI: | 5.990 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24785 | ||
Instability index: | 47.680 | ||
aromaticity | 0.118 | ||
GRAVY | -0.372 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.208 | ||
sheet | 0.224 |