Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650617.1 | 3prime_partial | 211 | 131-763(+) |
Amino Acid sequence : | |||
MVYTSPNEAILCTDSFQSMYTQMFCGLYHREEVLRVGAVFASGLLRAIRFLQLNWQQLADDIASGSLNPKITDPSIRECMSKLMIKPNPELAAFIVKECSSEEWEGIITRIWPKTKYLDV IVTGAMAQYIPTLDYYSGGLPLACTMYASSECYFGLNLKPMCKPSEVSYTIMPNMGYFEFLPHDPSFAYSTLNPQLLVDLVDVEIGKEYEL | |||
Physicochemical properties | |||
Number of amino acids: | 211 | ||
Molecular weight: | 23,870.403 | ||
Theoretical pI: | 4.701 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36245 | ||
Instability index: | 44.518 | ||
aromaticity | 0.118 | ||
GRAVY | 0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.232 | ||
sheet | 0.289 |