Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650619.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
ENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLCRSRALQVFHLDPSKWGVNVQPYSGSPANFAAYTALLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPY KVNSTTGYIDYDKLEEKALDFRPKLIICGGSAYPRDWDYARFRSVADKCGALLLCDMAHISGLVAAQEAANPFEYCDVVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKI NFA | |||
Physicochemical properties | |||
Number of amino acids: | 243 | ||
Molecular weight: | 21,436.015 | ||
Theoretical pI: | 11.370 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25105 | ||
Instability index: | 59.938 | ||
aromaticity | 0.053 | ||
GRAVY | -0.043 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.253 | ||
sheet | 0.189 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650619.1 | 5prime_partial | 190 | 730-158(-) |
Amino Acid sequence : | |||
GKIDLVLKIIHSILRLTLLWWLGPFPVKDHTSSWAPQALVGCGCHHITILKWVGSFLSSNKTANMSHITEQQRPALIRNRPKPGVIPIPGVRTSTTYNQFGSEIQRLLLQLIIIDIPSRR VHLIRQALEVNRGSRYLLPTRSVIPMSQVAARRKIETHNPIMGVEKSCVGSEIRGTTRIRLNIHTPFGRI* | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 21,436.015 | ||
Theoretical pI: | 11.370 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25105 | ||
Instability index: | 59.938 | ||
aromaticity | 0.053 | ||
GRAVY | -0.043 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.253 | ||
sheet | 0.189 |