Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650623.1 | 3prime_partial | 220 | 65-724(+) |
Amino Acid sequence : | |||
MLGLAAIAKTANLAPPTPPSAAHFQTYHTRTTAFSNKGTIFFPRSIASSSSSSSSNFGAVKAMAEVGTLSEAKSGCCSSVSGSKQALISLSDKQDLASLGKGLEGLGYTIVSTGGTASAL EAFDISVTKVEELTCFPEMLDGRVKTLHPNIHGGILAKRDQKNHMEALDRHGIGMFDVVVVNLYPFYDKVSSNSGITFEDGIENIDIGGPAMIRAAAKNH | |||
Physicochemical properties | |||
Number of amino acids: | 220 | ||
Molecular weight: | 13,516.497 | ||
Theoretical pI: | 4.619 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 60.324 | ||
aromaticity | 0.024 | ||
GRAVY | 0.007 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.268 | ||
sheet | 0.307 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650623.1 | complete | 127 | 528-145(-) |
Amino Acid sequence : | |||
MPPCILGCKVFTRPSSISGKQVSSSTLVTEISNASKADAVPPVDTIVYPKPSSPLPREAKSCLSDNDINACLEPETEEQQPDFASDKVPTSAIALTAPKLLLLEDEEEAMLLGKKIVPLL EKAVVLV* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 13,516.497 | ||
Theoretical pI: | 4.619 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 60.324 | ||
aromaticity | 0.024 | ||
GRAVY | 0.007 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.268 | ||
sheet | 0.307 |