Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650641.1 | internal | 288 | 3-866(+) |
Amino Acid sequence : | |||
LLHRSYLPLSLYRSIFFIRQTMESNYAATLSGLLKNAGDRFSSRRALSVSGKFDLSHSRLHFLIEHAAASLVASGVLPGDVVALTFPNTVEFVIMFLAVIRARATAAPLNQAYTADEFEF YLSDSESKILITPKEGNESAQSAAAKLNIPHVTASLSDAESEVSLCSTHPEFNSKSTQVELIERVVNQPSDVALFLHTSGTTSRPKGVPLTQFNLASSVQNIKSVYKLTESDSTVIVLPL FHVHGLLAGLLSSLGAGAAVTLPSAGRFSASTFWSDMIKYNANWYTAV | |||
Physicochemical properties | |||
Number of amino acids: | 288 | ||
Molecular weight: | 19,561.326 | ||
Theoretical pI: | 11.979 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 108.382 | ||
aromaticity | 0.065 | ||
GRAVY | -0.681 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.282 | ||
sheet | 0.188 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650641.1 | 5prime_partial | 170 | 2-514(+) |
Amino Acid sequence : | |||
SSSSFLSPSLSLSLHFLYQTDNGKQLRCDALRLAQERRRSVLFPPSPVRLRQVRSLPFSITFPHRTCRRFSRRLRRSSRRRRRSDLPKHRRVCDHVLGGNPSACYGGAAESGVHGGRVRV LLIRLRIEDLNHAERRKRIGSVRRGKAQHPSRYGFAFRRGIRGISLLDSP* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 19,561.326 | ||
Theoretical pI: | 11.979 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
Instability index: | 108.382 | ||
aromaticity | 0.065 | ||
GRAVY | -0.681 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.282 | ||
sheet | 0.188 |