Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650643.1 | internal | 276 | 3-830(+) |
Amino Acid sequence : | |||
LPHTLTTTIVSSNSSLSSSCSLFHPKTSQVNLSGKQIRQRRLVVPRNVTCSSNHKFGENRSSNSSINDHHEEYSNALVDRRNVLLGLGAGLYGFAGLNAADRLAVGAPIMPPDLSKCGPA DLPAGAKPTDCCPPENFKNIVDFKLPSPSSPMRVRPAAQLVDDAYIEKYKKAVALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLEIQIHNSWLFFPWHRYYLYFYERILGKLIN DPSFAIPYWNWDSPAGMVLPEFYADPKSPLYDHLRD | |||
Physicochemical properties | |||
Number of amino acids: | 276 | ||
Molecular weight: | 30,816.554 | ||
Theoretical pI: | 7.228 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41370 41745 | ||
Instability index: | 53.312 | ||
aromaticity | 0.105 | ||
GRAVY | -0.365 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.293 | ||
sheet | 0.225 |