Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650656.1	3prime_partial	253	117-875(+)
Amino Acid sequence :
MDRYKIIKEVGDGTFGSVWRAINKQTGEVVAIKKMKRKYYSWEECINLREVKSLRKMNHPNIVQLKEVIRENDILYFVFEYMECNLYQLMKDRGKLFSEAEVRNWCFQVFQGLAYMHQRG YFHRDLKPENLLVTKDLIKIADFGLAREISSQPPYTEYVSTRWYRAPEVLLQSSIYSSAVDMWAMGAIMAELFTLRPLFPGSSEADEIYKICSVIGTPTQNSWPQGLQLANGIKCQFPQF TSVHLSVLIPSAS
Physicochemical properties
Number of amino acids:		253
Molecular weight:		29,380.680
Theoretical pI:		8.686
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		52370 52620
Instability index:		40.475
aromaticity		0.123
GRAVY		-0.234
Secondary Structure Fraction
Helix		0.348
turn		0.209
sheet		0.249