Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650658.1 | internal | 259 | 3-779(+) |
Amino Acid sequence : | |||
LKPQVVVTGMSHFEAITSSSFEHLLDTTREIGSRLFLDISDHFELSSLPGSNGVLKYLAGNILPSHAAILCGLVKNQVYSDLEVAFVISEERNILKALSKTVELLEGNTALFSQYYYGCL FHELLSFQLADRRPSIQREGAKAKSTQMIGYSKSAISVLNDAELSFVEAENSSLIHMDVDHSFLPVPAPVKAAIFESFARQNIVESETDVRSGIQQFIKSNYGFTSDSSAEFIYGDSPLA LFSKLVLCCIQEGGTMCFP | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 28,481.063 | ||
Theoretical pI: | 5.060 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12170 | ||
Instability index: | 39.373 | ||
aromaticity | 0.097 | ||
GRAVY | 0.103 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.255 | ||
sheet | 0.278 |