Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650662.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
LTTLLAIFLQNWLTGGEEEEDMASSMNIERIEEGRIREESPRHHLNTMKKSFKTLVSKWWLLILNCVLFSIGTIGGPLLLRLYFLHGGSRRWIPAWSQSAGFPMLIFPIMFLYSRSPPGT KFLASPKFLLSGVAIGVLTGLDNFMYSYGLSFLPVSTSSLLLSTQLVFTAFFALIIVRHKFTPYSINAVVLMTLGSVLLGISKNADRPAGVTSAQYLLGFLITIGAACLLGFMLPCTEIA YTKAGKSMTYSSVLQFQLAAS | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 28,782.652 | ||
Theoretical pI: | 9.428 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39545 | ||
Instability index: | 52.640 | ||
aromaticity | 0.119 | ||
GRAVY | 0.513 | ||
Secondary Structure Fraction | |||
Helix | 0.395 | ||
turn | 0.257 | ||
sheet | 0.303 |