Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650673.1 | internal | 261 | 2-784(+) |
Amino Acid sequence : | |||
STLAHHQQPSAPATQNHQHFVGIPLQPTAAGDPNRPSVHPVGQHEISGAVHGFIPRVHYNLWTSIDPNSTSAAAGSHQDHQHHAIPTTGNSPISVSDVPSQLGIRRPVQQGLSLSLSSQQ PGYGHYRTESEIPAPAPVISPTSGDDMRVSGGSPSSASGVSNGTSGIQSVLLGSKYLKAAQQLLDEVVNVGNGIKTELSKESKDQNKISRDAAVVAGEGSNGGGGEAATSKRGSATDLTT AEKQELQMKKAKLVSMLDEVE | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 12,436.069 | ||
Theoretical pI: | 11.650 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 61.617 | ||
aromaticity | 0.062 | ||
GRAVY | -0.518 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.398 | ||
sheet | 0.150 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650673.1 | 5prime_partial | 113 | 3-344(+) |
Amino Acid sequence : | |||
PPLLIINNHRRRPPRTINTSSVYHFNRPLPGTQIALQSIPLVSMRYPAPFMASSHASTTISGRPSTQIPLPPPPDPTRTTSTMRFRPPETAPSASQTYPPNWVSVDPSSKVSL* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,436.069 | ||
Theoretical pI: | 11.650 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 61.617 | ||
aromaticity | 0.062 | ||
GRAVY | -0.518 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.398 | ||
sheet | 0.150 |