Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650681.1 | complete | 270 | 1-813(+) |
Amino Acid sequence : | |||
MRPRADVAYCIHALARRLSKTHNWTVALKTLIVIHRTLREGDPTFREELLNFSQRARVLQLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKYDIEAERLPRPAQGQEKGYSRTR DLESEELLEQLPALQQLLYRLIGCRPEGAAVGNYVIQYALALVLKESFKIYCAINDGIINLVDKFFEMPRHEAIKALEIYKRAGQQAGGLSDFYEICRGLELARNFQFPVLREPPQSFLS TMEEYIREAPRFVSVSREPLEFPRETPPDV* | |||
Physicochemical properties | |||
Number of amino acids: | 270 | ||
Molecular weight: | 13,322.166 | ||
Theoretical pI: | 10.409 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 70.541 | ||
aromaticity | 0.092 | ||
GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.325 | ||
sheet | 0.225 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650681.1 | complete | 120 | 425-63(-) |
Amino Acid sequence : | |||
MRRYSSCCNAGNCSSSSSLSKSRVLLYPFSCPWAGLGRRSASISYFKTLKHSSLSSKNSAYVRTHAEQSQAIGLESSLKFDSCRTRALWEKLRSSSLKVGSPSLRVLWITMRVFSATVQL * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,322.166 | ||
Theoretical pI: | 10.409 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 70.541 | ||
aromaticity | 0.092 | ||
GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.325 | ||
sheet | 0.225 |