Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650682.1 | internal | 239 | 2-718(+) |
Amino Acid sequence : | |||
ESVQVVQGDKYRSHIYGEGEKDTVWRLGAPPNYDVVNKLFEEGRTQVWSEDSMEGKVQRLVKTWEMEIVHKIRPQDFKTINAEKYRFSLNGEPPVTLDSLIKIGSYNAFLATSMPENFRG YNPAAETAESANKKFTTIFPRGFALEILQVYSGPPVIVYKFRHWSFMDGPFNGHAATGELIEFFGLGVFTLDESGRVEKVEFFYNPDQFLSQLLKGPSLDGSETSAATTTTAASATGCP | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 26,758.739 | ||
Theoretical pI: | 5.233 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35410 | ||
Instability index: | 31.467 | ||
aromaticity | 0.126 | ||
GRAVY | -0.382 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.255 | ||
sheet | 0.238 |