Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650686.1 | internal | 266 | 3-800(+) |
Amino Acid sequence : | |||
HAHPALQGELYNCINLTETIEEFESSWAALLDRYNLRKNDWLQALYNARHQWVPVYFRDSFFASISLNQPFETISSFFDGYVNQQTTLPLFFKQYERALEDWFSREIEADFDTICTTPIL KTPSPMEKQAANIYTKKIFAKFQEELVETFVYTANKIEGDGAISTYRVAKFEDDNKSYIVTFNVPEMRASCSCQMFEFSGILCRHVLTVFTVTNVLTLPSHYILKRWTRNAKSPVGPDDR GSELQGQESLTMRYNSLCREAIKFAE | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 30,916.579 | ||
Theoretical pI: | 5.383 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45380 45755 | ||
Instability index: | 49.908 | ||
aromaticity | 0.139 | ||
GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.195 | ||
sheet | 0.252 |