Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650689.1 | internal | 294 | 1-882(+) |
Amino Acid sequence : | |||
FNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVG NEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRN LFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNLINHV | |||
Physicochemical properties | |||
Number of amino acids: | 294 | ||
Molecular weight: | 32,223.255 | ||
Theoretical pI: | 8.608 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33350 33350 | ||
Instability index: | 46.218 | ||
aromaticity | 0.095 | ||
GRAVY | -0.062 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.306 | ||
sheet | 0.211 |