Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650690.1 | internal | 268 | 3-806(+) |
Amino Acid sequence : | |||
RVEVTMDGGDTWQVCELDHPEKPNKYGKYWCWCFWSLEVEVLDLLGAKEIAVRAWDQTLNTQPEKLIWNVMGMMNNCWFRVKMNVCKPHKGEIGLVFEHPTLAGNQSGGWMARQKHLETS EAQPTMKKSVSTPFMNTSAKTFSTSEVKKHNTAESCWIIVHGHVYDCTSFLKDHPGGADSILINAGTDCTEEFDAIHSDKAKKMLEDYRIGELITTGYTSDSSTSSPNNSVHGASSLNHL APIKEIVPTRLPALIPREKIPCKLVSKT | |||
Physicochemical properties | |||
Number of amino acids: | 268 | ||
Molecular weight: | 30,038.958 | ||
Theoretical pI: | 6.434 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56950 57450 | ||
Instability index: | 34.282 | ||
aromaticity | 0.078 | ||
GRAVY | -0.424 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.243 | ||
sheet | 0.231 |