Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650702.1 | 5prime_partial | 263 | 2-793(+) |
Amino Acid sequence : | |||
LGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPIL VNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNLINHVRNGTPKRPGRPIETYIFAMFNEDRKS PEFEKHFGLFYPSKQPVYPINFA* | |||
Physicochemical properties | |||
Number of amino acids: | 263 | ||
Molecular weight: | 29,327.770 | ||
Theoretical pI: | 8.683 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33350 33350 | ||
Instability index: | 42.403 | ||
aromaticity | 0.122 | ||
GRAVY | -0.267 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.316 | ||
sheet | 0.183 |