Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650707.1 | internal | 285 | 3-857(+) |
Amino Acid sequence : | |||
LEAMEDDDETPPVAVEIDRTTDANPSLPLDNSLKPPPTTEESVVGITVITGYLGAGKSTLINYVLNAQHGKKIAVILNEFGEEIGVEKAMINDGDGGALVEEWVELANGCVCCSVKHSLV QALEQLIQRKERLDHILLETTGLANPAPLASVLWLDDQLESAVKLDSIITVVDAKNLRLQLSEHRDASLFPEAFLQIAFADVVILNKVDLVSPVDSDSIALDVLSGLESEIYNINSLATI IRSVRCNVDLSMILDCKAYDSKHLAHLDSLLKESQSLSTRNLHDC | |||
Physicochemical properties | |||
Number of amino acids: | 285 | ||
Molecular weight: | 30,974.865 | ||
Theoretical pI: | 4.440 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
Instability index: | 39.776 | ||
aromaticity | 0.035 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.218 | ||
sheet | 0.312 |