Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650726.1 | complete | 233 | 27-728(+) |
Amino Acid sequence : | |||
MAGEKAVKLIGSWASLFGLRVSVALNLKSIDYEFLQEQMGTKSDLLLKSNPVYKKIPVLLHNGKPICESLIIVQYIDETWTSAPSILPSDPYDRAIARFWGTYIDDKLYPSLTGILMAQG EEAKAEAIAQTIGSLELLEKAFQECSKGKGFYGGDQIGYLDIAVGSYVAVIKVAETLGNVKLLDEAKFPGLAGWAERFSTHEAVKNVIPEHDKLLDLAKQFQAMRAAPPPPSN* | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 11,762.771 | ||
Theoretical pI: | 9.572 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7825 | ||
Instability index: | 81.236 | ||
aromaticity | 0.120 | ||
GRAVY | 0.010 | ||
Secondary Structure Fraction | |||
Helix | 0.370 | ||
turn | 0.210 | ||
sheet | 0.260 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650726.1 | complete | 100 | 659-357(-) |
Amino Acid sequence : | |||
MLRNHIFYCFVSREPLRPSRKARELRLVKQLHIAQCFCDLNHRYIAPYCNIKVPNLVSPVESLPFAALLKSFLQQLQRSNCLSYGFRFCLLSLCHQYASQ* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,762.771 | ||
Theoretical pI: | 9.572 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7825 | ||
Instability index: | 81.236 | ||
aromaticity | 0.120 | ||
GRAVY | 0.010 | ||
Secondary Structure Fraction | |||
Helix | 0.370 | ||
turn | 0.210 | ||
sheet | 0.260 |