Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650727.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
NKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGN EVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNL FDALVDSVYASLE | |||
Physicochemical properties | |||
Number of amino acids: | 253 | ||
Molecular weight: | 28,051.758 | ||
Theoretical pI: | 8.970 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 47.573 | ||
aromaticity | 0.099 | ||
GRAVY | -0.041 | ||
Secondary Structure Fraction | |||
Helix | 0.360 | ||
turn | 0.292 | ||
sheet | 0.213 |