Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650729.1 | 3prime_partial | 263 | 19-807(+) |
Amino Acid sequence : | |||
MAASMACSTALLLLLCSLCGICTTNAQLSPNFYATSCPNLQTIVLGAMRQAVNREPRMGASILRLFFHDCFVNGCDGSILLDDTPTFTGEKNAGPNRNSARGFDVIDTIKSQVEAACSGI VSCADILAIAARDGVVLLGGQSWTVPLGRRDSRTASQSAANAQIPAPSFNFANLVSSFAAKGLNVRDLTSLSGGHSIGQARCISFRNRIYNGSSIDPNFALLRRRTCPPSGGDNNLAPLD STPIRFDNNYYQNIVANRGLLNS | |||
Physicochemical properties | |||
Number of amino acids: | 263 | ||
Molecular weight: | 15,590.694 | ||
Theoretical pI: | 9.679 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 48.552 | ||
aromaticity | 0.085 | ||
GRAVY | -0.222 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.277 | ||
sheet | 0.284 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650729.1 | complete | 141 | 644-219(-) |
Amino Acid sequence : | |||
MRFLKLMQRAWPMEWPPERDVRSRTLRPLAANEETRFAKLNDGAGIWAFAALWLAVLESLRPSGTVHDCPPSRTTPSRAAIASMSAHETIPLHAASTCDLMVSITSNPRAEFRFGPAFFS PVNVGVSSSKIDPSHPFTKQS* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,590.694 | ||
Theoretical pI: | 9.679 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 48.552 | ||
aromaticity | 0.085 | ||
GRAVY | -0.222 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.277 | ||
sheet | 0.284 |