Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650739.1 | internal | 266 | 3-800(+) |
Amino Acid sequence : | |||
KFRSHNDNNNINRRSSIVESTSGGAIQKKKGMVLPFVPHSITFEDIKYSVDMPAEMKAQGIEEDRLTLLKGISGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGNITISGYPKK QETFARISGYCEQNDIHSPYVTVYESLLYSAWLRLPSDVDSDTRKMFVEEIMELIELTPLRGMLVGLPGVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVD TGRTVVCTIHQPSIDIFEAFDELFLM | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 10,216.430 | ||
Theoretical pI: | 4.810 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 56.421 | ||
aromaticity | 0.040 | ||
GRAVY | 0.503 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.380 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650739.1 | complete | 100 | 748-446(-) |
Amino Acid sequence : | |||
MVHTTVLPVSTVFLTVLITIAAALASSPDVGSSMNIIEGFATSSTAIVSLFRCSVESPSTPGSPTSIPLNGVNSISSMISSTNIFLVSESTSEGNRSHAE* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,216.430 | ||
Theoretical pI: | 4.810 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 56.421 | ||
aromaticity | 0.040 | ||
GRAVY | 0.503 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.380 | ||
sheet | 0.220 |