Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650742.1	internal	277	3-833(+)
Amino Acid sequence :
FISLAIPFSAMASLPLLSMVLCFLSLSMKVSYAALPSELYWQSLLPNTPIPKAVQDLLPPAGKINKPASIGVQPTSIPQYARYASEEQLRQKDYSYFFLEKDLHPGTKLNLHFTKTTTET AFLPRKVAESIPFSSTKLPDILNRFSVKPGSREAEVIKQTIEDCESPAIQGEDRYCATSLESMVDYCAAKLGKNAKVVATKVNDDKITPKQQYTIEEGVKEMGGDKSMVCHNQNYAYAVF YCHLTLKTKAYLVPLVGADDTKVNAVAVCHSDTSKWN
Physicochemical properties
Number of amino acids:		277
Molecular weight:		30,687.008
Theoretical pI:		8.100
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		30370 30745
Instability index:		41.806
aromaticity		0.090
GRAVY		-0.181
Secondary Structure Fraction
Helix		0.303
turn		0.227
sheet		0.264