Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650763.1	3prime_partial	278	32-865(+)
Amino Acid sequence :
MANPNGNDHPHHDPLLPSAHPEPENCFLTSHLLAEGDIEPINGARDFFKRFGAESKKLWFLAGPAIFASLCQYSISAITQTLVGHVGNLELAAISIGNGVIVSFSYGIMMGMGSALETLC GQAYGAGQMDMLGVYMQRSWLILGATGLLLSILYIFSEYLLVAIGQDKEIARVAGKFVIWVIPQLFAYAMNFPIAKFLQAQSKMMAMAVISLVSLVLHAVFSWVLIFKLQWGLIGAAVML NVSWWFLVLAQLAYIFSGTCGRAWSGFSWKAFQSLWGF
Physicochemical properties
Number of amino acids:		278
Molecular weight:		12,499.933
Theoretical pI:		8.860
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		17990 18115
Instability index:		72.407
aromaticity		0.068
GRAVY		-0.184
Secondary Structure Fraction
Helix		0.237
turn		0.415
sheet		0.169

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650763.1	5prime_partial	118	3-359(+)
Amino Acid sequence :
NPPTTFTHNPWQTQTVMTTPTTTLSSQAHIQNPKTVFSPPTYSQRATLNPSMALAISSNGLVPSPKSCGSSPVQPFSLPCVSTPSLPSLRPWWVTLEISSSLLFPSETVSSSASPTAS*
Physicochemical properties
Number of amino acids:		118
Molecular weight:		12,499.933
Theoretical pI:		8.860
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		17990 18115
Instability index:		72.407
aromaticity		0.068
GRAVY		-0.184
Secondary Structure Fraction
Helix		0.237
turn		0.415
sheet		0.169