Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650764.1 | internal | 283 | 3-851(+) |
Amino Acid sequence : | |||
PICYGQDIRLVKTEEMSSGTGQGNLKREVHFPNECAGSSYPSGSDFLSKVSVQRCKEAFQEGYTIALRGMEFRSEIVAAISDKLALMFGQPSVGANAYLTPPKSQGLVRHYDDHCVFVCQ LVGQKKWRVFPPSTLSLPRLYEPCESLVRSGSDDTVASGCNEFLLREGDILYIPRGCPHEAFTIVDDNGFAMDGAPVGFSLHLTFGIEVEPPFEWEGFAHAALYSWSQNQLQPPSQMLDD SLCCMLDALSINLLHVGIQLIGSYDPIFRKACMVAGISSPSLD | |||
Physicochemical properties | |||
Number of amino acids: | 283 | ||
Molecular weight: | 11,800.191 | ||
Theoretical pI: | 10.666 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 71.449 | ||
aromaticity | 0.069 | ||
GRAVY | -1.142 | ||
Secondary Structure Fraction | |||
Helix | 0.208 | ||
turn | 0.248 | ||
sheet | 0.178 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650764.1 | 5prime_partial | 101 | 852-547(-) |
Amino Acid sequence : | |||
DQGMARRFQQPCKPSERWDRNSQSAGSQHAKDLWTKHLAYSIKNHPAFVMVVVTGFGSKNREQHEQNPPTQREVPLQSQMSSVKRTQRVHRPLQTHYRPLL* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,800.191 | ||
Theoretical pI: | 10.666 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 71.449 | ||
aromaticity | 0.069 | ||
GRAVY | -1.142 | ||
Secondary Structure Fraction | |||
Helix | 0.208 | ||
turn | 0.248 | ||
sheet | 0.178 |