Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650784.1 | internal | 288 | 3-866(+) |
Amino Acid sequence : | |||
CWCFWSLEVEVLDLLGAKEIAVRAWDQTLNTQPEKLIWNVMGMMNNCWFRVKMNVCKPHKGEIGLVFEHPTLAGNQSGGWMARQKHLETSEAQPTMKKSVSTPFMNTSAKTFSTSEVKKH NTAESCWIIVHGHVYDCTSFLKDHPGGADSILINAGTDCTEEFDAIHSDKAKKMLEDYRIGELITTGYTSDSSTSSPNNSVHGASSLNHLAPIKEIVPTRLPALIPREKIPCKLVSKTSI SHDVRVFRFALPSPDQVLGLPVGKHIFLCANIDGKLCMRAYTPSSSVD | |||
Physicochemical properties | |||
Number of amino acids: | 288 | ||
Molecular weight: | 31,916.302 | ||
Theoretical pI: | 7.278 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44460 45085 | ||
Instability index: | 41.263 | ||
aromaticity | 0.073 | ||
GRAVY | -0.228 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.253 | ||
sheet | 0.229 |