Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650799.1 | internal | 256 | 2-769(+) |
Amino Acid sequence : | |||
CYVGTWTRGLKDGKGAFYPNGSRLPATQELYFNALRKRGLLPDLRKPTHVSRIRHANSIDMGNIKMSESQEFHHGSSDKLPKGNLLNLAESRTKNVALERRWSLEVAIEKVIGHDLSLNS GESVPEDNEKDGKTNVPILEREYMQGVLISELVLSDRFSPSSRKSRRRHKKHTKEIKRPGETIIKGHRSYDLMLSLQLGIRYTVGKITPIQSREVRTSDFGPRASFWMNFPKEGSQLTPP HQSDDFKWKDYCPMVF | |||
Physicochemical properties | |||
Number of amino acids: | 256 | ||
Molecular weight: | 29,304.066 | ||
Theoretical pI: | 9.757 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32555 | ||
Instability index: | 53.561 | ||
aromaticity | 0.078 | ||
GRAVY | -0.759 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.273 | ||
sheet | 0.215 |