Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650816.1 | internal | 276 | 3-830(+) |
Amino Acid sequence : | |||
QTIDELHSLQKKKSAPTTPIKDADGTFAIISEEERQMLQLQSISASLASLTRETGPKLVRGDQARKVEAAKVSNVVDYTPAISVSDSSLKSTQVLHNLSPAELYEQAIKYEKGSFITSTG ALATLSGAKTGRSPRDKRVVRDETTEDELWWGKGSPNIEMDEHTFLVNRERAVDYLNSLDKVFVNDQFLNWDPEHRIKVRIVSARAYHSLFMHNMCIRPTPEELEDFGTPDFTIYNAGQF PCNRYTHYMTSSTSIDLNLARREMVILGTQYAGGNE | |||
Physicochemical properties | |||
Number of amino acids: | 276 | ||
Molecular weight: | 31,020.440 | ||
Theoretical pI: | 5.723 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
Instability index: | 38.456 | ||
aromaticity | 0.076 | ||
GRAVY | -0.528 | ||
Secondary Structure Fraction | |||
Helix | 0.272 | ||
turn | 0.228 | ||
sheet | 0.254 |