Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650846.1 | internal | 215 | 2-646(+) |
Amino Acid sequence : | |||
SRLVAAATEQLNTLPFYHSFWNRTTKPSLDLAKVLLETFTARQMGKVFFTNSGSEANDSQVKLVWYYNNALGRPDKKKFIARTKSYHGSTLISASLSGLSALHQKFDLPAPFVLHTDCPH YWRFHLPGESEEEFSTRLANNLENLILKEGPETIAAFIAEPVMGAGGVIPPPATYFEKIQAVVKKYDILFIADEVICAFGRLGTMFGCDRYNIKP | |||
Physicochemical properties | |||
Number of amino acids: | 215 | ||
Molecular weight: | 24,081.328 | ||
Theoretical pI: | 8.364 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
Instability index: | 39.094 | ||
aromaticity | 0.121 | ||
GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.233 | ||
sheet | 0.270 |