Acc_NO	ORF type	length	start-end position (strand +/-)
>JG650859.1	internal	257	1-771(+)
Amino Acid sequence :
SRSSLIRGESLRVFSFKFRVRAMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMA RGNAAVPAMEMTKWFDTNYHFIVPELGPDTKFSYASHKAVNEYNEAKALGVDTVPVLVGPVSYLLLSKHAKGVDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEK LKAFTAAYSELESTLSG
Physicochemical properties
Number of amino acids:		257
Molecular weight:		28,421.061
Theoretical pI:		6.226
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		43890 43890
Instability index:		31.059
aromaticity		0.117
GRAVY		-0.101
Secondary Structure Fraction
Helix		0.327
turn		0.245
sheet		0.288