Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650859.1 | internal | 257 | 1-771(+) |
Amino Acid sequence : | |||
SRSSLIRGESLRVFSFKFRVRAMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMA RGNAAVPAMEMTKWFDTNYHFIVPELGPDTKFSYASHKAVNEYNEAKALGVDTVPVLVGPVSYLLLSKHAKGVDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEK LKAFTAAYSELESTLSG | |||
Physicochemical properties | |||
Number of amino acids: | 257 | ||
Molecular weight: | 28,421.061 | ||
Theoretical pI: | 6.226 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 43890 | ||
Instability index: | 31.059 | ||
aromaticity | 0.117 | ||
GRAVY | -0.101 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.245 | ||
sheet | 0.288 |