Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650866.1 | 3prime_partial | 255 | 39-803(+) |
Amino Acid sequence : | |||
MAVTDQCIGSHSSETLVDCNVLIARALVKAGVDCMFGVVGIPVTSLANRALAAGIRFIAFHNEQSAGYAASAYGYLTGRPGVLLTVSGPGCVHGLAGLSNAGANAWPMIMISGSCDQRDF GKGDFQELDQIEAVKPFVKFAAKAKDISEIPNHVFEVLSRSISGRPGGCYLDVPSDVLHQSVPEAEAVRLLKEAAAKSESETNANGIGGFGEIAKAVALLREAERPLIVFGKGAALARSE NELKKLVETTGIPFL | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 13,600.542 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 98.421 | ||
aromaticity | 0.126 | ||
GRAVY | -0.948 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.306 | ||
sheet | 0.108 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650866.1 | 5prime_partial | 233 | 803-102(-) |
Amino Acid sequence : | |||
QERNSSRLHQFLQLIFRSRQGRTFPKHNQRPLSLSQQRYGFCNLSKPTNSICICFALAFCCCLLQKPNSLSFRNRLVKNIRRNIQITPARTTRDRSTQNLKHVIRDFRNILRFRSELHEG FYCFNLIELLKITLPEVPLIARAGDHNHRPSVRTGVRESSEAVHAAGAGDGEENAGAAGQVSIRGRGVAGGLLVVKRDESDSSSQGSVRQRGNRNSDDAEHAIDTSFDESSSN* | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 13,600.542 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 98.421 | ||
aromaticity | 0.126 | ||
GRAVY | -0.948 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.306 | ||
sheet | 0.108 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650866.1 | 5prime_partial | 111 | 2-337(+) |
Amino Acid sequence : | |||
FFFFFFFFELISNGGHRSVHRISQFRNPSRLQRPNCSSSRQSWCRLHVRRRRNSGYLSGEPSPGCWNPIHRVSQRAVRRLRRVRVWIPDRPPRRSPHRLRPRLRARPRWTL* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 13,600.542 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 98.421 | ||
aromaticity | 0.126 | ||
GRAVY | -0.948 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.306 | ||
sheet | 0.108 |