Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650876.1 | 3prime_partial | 266 | 32-829(+) |
Amino Acid sequence : | |||
MSVTLATIKALFMAPFLRLIHKDFHQLVAKMTLLDRLLFLIMHTVDKMGIWHRLPVFLGLMYLAIRRHLLNQYNLINVGKTPVGMRFNPADYPYRTADGKFNDPFNEVAGSQGTFFGRNI FPVQQKDKLMKPDPMVVATKLLTRKTFKDTGKQFNMIAASWIQFMIHDWVDHLEDTKQIELTAPEEVASQCPLKSFRFYKTLEVSTGFYDIKSGHLNTRTPWWDGSVIYGSNYEKLSKVR TFKDGKLKISKDDLLLHDQDGVALSG | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 30,635.379 | ||
Theoretical pI: | 9.482 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39420 | ||
Instability index: | 31.116 | ||
aromaticity | 0.117 | ||
GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.188 | ||
sheet | 0.237 |