Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650899.1 | 5prime_partial | 254 | 1-765(+) |
Amino Acid sequence : | |||
TRYYEILGVSKNASQDDLKRAYKKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGAGGHDPFDIFSSFFGGNPFGGGGSSRGRRQRRGEDVIHPLKVSLED LYSGTSKKLSLSRNVICSKCNGKGSKSGASMKCHGCQGSGIKVSIRQLGPSMIQQMQHACNECKGTGETINDKDRCPQCKGEKVVQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTITG DIVFVLQQKEHPKF* | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 27,734.990 | ||
Theoretical pI: | 8.507 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10930 | ||
Instability index: | 30.574 | ||
aromaticity | 0.063 | ||
GRAVY | -0.778 | ||
Secondary Structure Fraction | |||
Helix | 0.220 | ||
turn | 0.280 | ||
sheet | 0.193 |