Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650919.1 | internal | 233 | 3-701(+) |
Amino Acid sequence : | |||
SFLFFRFHTMKPLHFRFTTTSCIFLYILILSKVVLATTSSLAANQDLLSCLDSNGVRNYTTFSTSVDQDYHHILNLVIQNPMFKRPTYNKPSVIVLPTTKEELASTILCCRRGLWDMRIR SGGHSYEGLSHRAETPFVLVDVMNLNRIDINLESETAWVESGVRLGEIYYAISQASDSLGFSAGICPTVGSGGHISGGGYGMMSRKYGLASDNVVDAILIDANGEIRDRESMG | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 25,805.173 | ||
Theoretical pI: | 6.363 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24660 | ||
Instability index: | 41.237 | ||
aromaticity | 0.094 | ||
GRAVY | 0.030 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.266 | ||
sheet | 0.227 |