Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650922.1 | internal | 265 | 1-795(+) |
Amino Acid sequence : | |||
PATPTSLTDPMLFPSYAPPTSSWGPNHRRSFSFTDACLGSSDASGSGLGGWKPCLYYARGYCKNGASCKFLHGLPDSPDSGSMVGSPAKLDVMEQCQELLLRSKTQQQQQQQQQHQRLNP ASQIFSPAAASLPYATASTKCINFLLQQHQYEAQQRASAAASLMLGEDMHKFSRSRIEKNELLNNGAMLSNAGSRQIYLTFPADSTFREEDVSNYFSIYGPVQDVRIPFQQKRMFGFVTF VYPETVKLILAKGNPHFVCDARVLV | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 12,882.723 | ||
Theoretical pI: | 5.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 62.174 | ||
aromaticity | 0.068 | ||
GRAVY | 0.039 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.342 | ||
sheet | 0.265 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650922.1 | 5prime_partial | 117 | 2-355(+) |
Amino Acid sequence : | |||
LLPLPPLLIPCFSLLTPLQLHLGDPTTVEVSPSPTLVSAPPMLPALGWADGNRVFTTLEDTVRTVPAVSSFMAFLIRPTRDPWLDLRPSLMSWNSARSYCLDPRLNSSSSNNNNIRD* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 12,882.723 | ||
Theoretical pI: | 5.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 62.174 | ||
aromaticity | 0.068 | ||
GRAVY | 0.039 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.342 | ||
sheet | 0.265 |