Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650935.1 | internal | 269 | 2-808(+) |
Amino Acid sequence : | |||
FKYKVAGDDSSKFHAFHVGSRDVNSWFAPKPVRNVQSPVSRIVGFNSGASDFLLRGPEELQSSVVGIIDDDTVTREKLVRKRLMSPLNGMLYPNKFCGDPLEPIGKNFQIESSVLSDKFN VILSQDHKKANTASSNSLESPIPSPSSYSNWDSTLAGKSITCSTFTDGPLLEHEEIVHPHRNSSSLLETIPIGETMKVRSQTGVLSISPKKVHSPPLSLSPLGPKFSERMKVAEAGKNSR KKIEGEHFILKNIERSLDRAVSGVLFSQE | |||
Physicochemical properties | |||
Number of amino acids: | 269 | ||
Molecular weight: | 29,589.194 | ||
Theoretical pI: | 8.973 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 55.150 | ||
aromaticity | 0.067 | ||
GRAVY | -0.422 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.331 | ||
sheet | 0.201 |