Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650937.1 | 3prime_partial | 245 | 67-801(+) |
Amino Acid sequence : | |||
MEKGGGGGLALAIDSDTIGGFLATKQTPLMSSFLDHHHHQATTSNSHFKRKIDLLDCAPVNATSSTATTTKFPGLDFSMSLNCGEDDRVFSGSLNSESKRPVVGEMDFFSDKRIKSNGFE GKFVGTKKETFDVNTGLNLLTANSASDQSTVEDALMSSTMEDRKRKSELAALQAELDRMNEENQKLKAMLTQVNNNYNTLQMHILTLMQQQERKSQMIEAGKVEEADKKHVHDQGGVNNG GSMVP | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 12,409.588 | ||
Theoretical pI: | 11.256 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 56.170 | ||
aromaticity | 0.075 | ||
GRAVY | 0.183 | ||
Secondary Structure Fraction | |||
Helix | 0.411 | ||
turn | 0.206 | ||
sheet | 0.234 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650937.1 | complete | 107 | 675-352(-) |
Amino Acid sequence : | |||
MHLKSVVVVVDLGKHRFQLLIFFIHPIKLSLKSSQLALSFPVFHGRRHQRIFYSRLITGRVCSQKIQSSINIESLLLGTNKLALETIRLNSLIREEIHLTHNRPFTL* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,409.588 | ||
Theoretical pI: | 11.256 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 56.170 | ||
aromaticity | 0.075 | ||
GRAVY | 0.183 | ||
Secondary Structure Fraction | |||
Helix | 0.411 | ||
turn | 0.206 | ||
sheet | 0.234 |